remote management invalid profile meraki

Cabecera equipo

remote management invalid profile meraki

"useSimpleView" : "false", "action" : "rerender" { "action" : "rerender" "event" : "ProductMessageEdit", "action" : "rerender" "context" : "", { ] }, "event" : "ProductAnswerComment", }, Are you sure you want to proceed? "context" : "envParam:quiltName,product,contextId,contextUrl", }, Step 1: Select the Bypass MDM unlock mode first on the main interface after you download the program on your computer. { "event" : "addThreadUserEmailSubscription", Invalid Profile". "context" : "lia-deleted-state", } "eventActions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", { } "event" : "unapproveMessage", "actions" : [ "event" : "MessagesWidgetMessageEdit", "initiatorBinding" : true, ] "actions" : [ { } }, ] "truncateBody" : "true", { { "componentId" : "kudos.widget.button", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineMessageReply"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_20","action":"renderInlineMessageReply","feedbackSelector":"#inlineMessageReplyContainer_20","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:renderinlinemessagereply?t:ac=board-id/enterprise-mobility-management/message-id/8511/thread-id/8511&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"cbAMJt7ZxzVqisZw1i0eU41dJoF_pLm5D353S9zltjw. { { ] }); "context" : "", "useCountToKudo" : "false", }, { ] "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "envParam:quiltName,expandedQuiltName", ] } ] "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" { "event" : "MessagesWidgetEditAction", LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "action" : "rerender" { "event" : "deleteMessage", }, "actions" : [ { "action" : "rerender" } "event" : "ProductAnswerComment", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); "action" : "rerender" } }); "useTruncatedSubject" : "true", }, }, { { { ] { ] "context" : "envParam:quiltName", "action" : "rerender" }, "eventActions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", if ( e.keyCode === 13 ) { ] Select the device using the check box on the left and click Reset Token from the More Actions on the top. } "actions" : [ { "event" : "expandMessage", "action" : "rerender" }, "eventActions" : [ "context" : "envParam:quiltName", "action" : "pulsate" "disableLinks" : "false", "initiatorBinding" : true, "event" : "MessagesWidgetEditCommentForm", ] }, { "actions" : [ }, "actions" : [ "event" : "ProductAnswer", "event" : "ProductAnswer", "actions" : [ "quiltName" : "ForumMessage", "action" : "rerender" "actions" : [ ] } ] "disallowZeroCount" : "false", "context" : "lia-deleted-state", "revokeMode" : "true", { ] } thumb_up thumb_down Chubbs "context" : "", "useSubjectIcons" : "true", We don't have a HR department Large organisation pretending it is small with a very odd management structure. { Is anyone else having issues today configuring new iOS/iPadOS devices with Meraki + DEP? { } { "action" : "rerender" { "entity" : "19924", "actions" : [ }, "context" : "envParam:quiltName,message", "event" : "ProductMessageEdit", "action" : "rerender" }, "event" : "ProductMessageEdit", } "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "disableKudosForAnonUser" : "false", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineMessageReply"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_2","action":"renderInlineMessageReply","feedbackSelector":"#inlineMessageReplyContainer_2","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:renderinlinemessagereply?t:ac=board-id/enterprise-mobility-management/message-id/8511/thread-id/8511&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"GMpcbnauvMj_TNzDK1CWvAHW-nAnTx63KlzxEGNSenA. } "actions" : [ { { "actions" : [ "selector" : "#kudosButtonV2_19", "event" : "ProductMessageEdit", "useCountToKudo" : "false", "event" : "QuickReply", { ] }, "event" : "deleteMessage", "context" : "", "displayStyle" : "horizontal", { "context" : "envParam:selectedMessage", ', 'ajax'); { { ', 'ajax'); "displaySubject" : "true" I wish users could see what I can view in Dashboard, there is this large misconception that I can see text messages, phone calls, photos, and other personal data. "}); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineMessageReply"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_8","action":"renderInlineMessageReply","feedbackSelector":"#inlineMessageReplyContainer_8","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:renderinlinemessagereply?t:ac=board-id/enterprise-mobility-management/message-id/8511/thread-id/8511&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"vdnS4qMuyn0csW62B_0vHjgkMHXETjRRU6FvF7iW2co. "action" : "rerender" { } "event" : "MessagesWidgetMessageEdit", LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","linearDisplayViewSelector":".lia-linear-display-message-view","renderEventParams":{"replyWrapperId":"replyWrapper_2","messageId":129643,"messageActionsId":"messageActions_2"},"threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","isRootMessage":false,"replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. { { "action" : "rerender" "action" : "pulsate" ","loaderSelector":"#threadeddetaildisplaymessageviewwrapper_13 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_11","menuItemsSelector":".lia-menu-dropdown-items"}}); ] } "parameters" : { "}); { } "action" : "rerender" "actions" : [ } "action" : "rerender" "actions" : [ "event" : "approveMessage", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_0","feedbackSelector":".InfoMessage"}); "context" : "", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); "useSubjectIcons" : "true", "actions" : [ ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#threadeddetaildisplaymessageviewwrapper_20","action":"renderInlineEditForm","feedbackSelector":"#threadeddetaildisplaymessageviewwrapper_20","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist.threadeddetaildisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/enterprise-mobility-management/message-id/8511/thread-id/8511","ajaxErrorEventName":"LITHIUM:ajaxError","token":"h4PQG3plmuwVie1N80J8pD3A2bUigFeu03Qdidw9860. "actions" : [ "parameters" : { "action" : "rerender" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { ] "componentId" : "kudos.widget.button", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "kudosable" : "true", { { "action" : "rerender" { "disallowZeroCount" : "false", ] "}); "context" : "envParam:quiltName", { "actions" : [ "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); } "}); { "action" : "rerender" "action" : "pulsate" LITHIUM.MessageThreadedDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddisplay_0","rootMessageComponentSelector":"#threadeddisplay_0","editEvent":"LITHIUM:editMessageViaAjax","confirmationText":"You have other message editors open and your data inside of them might be lost. "actions" : [ "event" : "expandMessage", "revokeMode" : "true", { "event" : "removeThreadUserEmailSubscription", { { "action" : "rerender" } "message" : "60892", "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'rBXDEOLcUb2nL1pvOdu7mm20pVpl2U5E7QHluyP0dxA. "linkDisabled" : "false" "quiltName" : "ForumMessage", "eventActions" : [ "action" : "rerender" "context" : "", Are there more than one icon/button? "action" : "pulsate" "useTruncatedSubject" : "true", "context" : "envParam:quiltName,message", { "context" : "envParam:quiltName,message,product,contextId,contextUrl", } ], ] } "actions" : [ ] "actions" : [ ] ] "action" : "rerender" // }, "kudosable" : "true", "event" : "expandMessage", } "event" : "deleteMessage", { ] "context" : "lia-deleted-state", "event" : "addThreadUserEmailSubscription", "context" : "envParam:quiltName,message", "action" : "rerender" "event" : "ProductAnswerComment", ] "context" : "envParam:quiltName", "event" : "addMessageUserEmailSubscription", { }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lazyLoadScripts"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_15","action":"lazyLoadScripts","feedbackSelector":"#inlineMessageReplyContainer_15","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:lazyloadscripts?t:ac=board-id/enterprise-mobility-management/message-id/8511/thread-id/8511&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"glw4PQuWmhACV1Lyf67NQNZSxYPPWQHgYWnd4UOy60I. "disableLabelLinks" : "false", "forceSearchRequestParameterForBlurbBuilder" : "false", { "action" : "rerender" "revokeMode" : "true", "action" : "rerender" "event" : "kudoEntity", "context" : "envParam:quiltName", "parameters" : { { { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#threadeddetaildisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#threadeddetaildisplaymessageviewwrapper_7","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist.threadeddetaildisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/enterprise-mobility-management/message-id/1516/thread-id/1516","ajaxErrorEventName":"LITHIUM:ajaxError","token":"MH2sbogLh1R8Qxg8uy9G8D2lxEe65HpnvUeTS_wcgoo. "event" : "editProductMessage", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_77","feedbackSelector":".InfoMessage"}); }, }, "eventActions" : [ "actions" : [ "initiatorBinding" : true, } "actions" : [ LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","linearDisplayViewSelector":".lia-linear-display-message-view","renderEventParams":{"replyWrapperId":"replyWrapper_15","messageId":129667,"messageActionsId":"messageActions_15"},"threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","isRootMessage":false,"replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. "action" : "rerender" "action" : "rerender" { "action" : "rerender" "actions" : [ { "action" : "rerender" ] "forceSearchRequestParameterForBlurbBuilder" : "false", } ] { ] "action" : "rerender" }, } } { "disableLinks" : "false", "messageViewOptions" : "1111110111111111111110111110100101011101", "event" : "MessagesWidgetEditAnswerForm", ","messageActionsSelector":"#messageActions_4","loaderSelector":"#loader","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_4","layoutView":"threaded","replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true,"loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false}); "action" : "rerender" }, ] { "entity" : "12134", } }, "actions" : [ } ] ] "action" : "rerender" "action" : "rerender" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_0","menuItemsSelector":".lia-menu-dropdown-items"}}); { "context" : "", }, "event" : "MessagesWidgetCommentForm", "componentId" : "labels.widget.labels.sortable", "action" : "rerender" // just for inline syntax-highlighting "disableKudosForAnonUser" : "false", { { "action" : "rerender" { "revokeMode" : "true", }, "action" : "rerender" "actions" : [ "event" : "RevokeSolutionAction", { } { "selector" : "#messageview", "event" : "QuickReply", { Remember to save changes at the bottom to create your profile! "initiatorBinding" : true, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lazyLoadScripts"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_10","action":"lazyLoadScripts","feedbackSelector":"#inlineMessageReplyContainer_10","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:lazyloadscripts?t:ac=board-id/enterprise-mobility-management/message-id/8511/thread-id/8511&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"nge_hSw5Ika_yfQNQ1nJNvJvPeQg4vwQE6g0vwll40g. }, "actions" : [ }, "actions" : [ "event" : "MessagesWidgetMessageEdit", { "displaySubject" : "true" }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"useLoader":true,"blockUI":"","event":"LITHIUM:reRenderInlineEditor","parameters":{"clientId":"inlinemessagereplyeditor_0"}},"tokenId":"ajax","elementSelector":"#inlinemessagereplyeditor_0","action":"reRenderInlineEditor","feedbackSelector":"#inlinemessagereplyeditor_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.inlinemessagereplyeditor_0:rerenderinlineeditor?t:ac=board-id/enterprise-mobility-management/message-id/2304/thread-id/2304","ajaxErrorEventName":"LITHIUM:ajaxError","token":"cdS05FAx-LOZ2aTdrltfu8MbWqMcDU70P8kB2DwEO-U. } } "event" : "AcceptSolutionAction", "event" : "MessagesWidgetEditAnswerForm", "initiatorDataMatcher" : "data-lia-kudos-id" Description: This field can be used to provide additional information about a profile to other Dashboard users. "useSubjectIcons" : "true", }, { "entity" : "62982", "actions" : [ "event" : "ProductAnswerComment", { }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); { }, } Might be more of a global Meraki issue than an iOS specific issue, but I'm unable to verify due to some extenuating circumstances with our Android deployments. "action" : "rerender" "context" : "envParam:selectedMessage", { "action" : "rerender" "kudosLinksDisabled" : "false", "actions" : [ } LITHIUM.AjaxSupport.fromLink('#kudoEntity_13', 'kudoEntity', '#ajaxfeedback_13', 'LITHIUM:ajaxError', {}, 'yX-mVc2NdJX7ub1g518UXu9gpPj7XFB84vrAx7lwzR0. ] "actions" : [ "actions" : [ "useSimpleView" : "false", "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, { "includeRepliesModerationState" : "true", }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper_0","componentSelector":"#threadeddetaildisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":12123,"confimationText":"You have other message editors open and your data inside of them might be lost. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineMessageReply"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_0","action":"renderInlineMessageReply","feedbackSelector":"#inlineMessageReplyContainer_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:renderinlinemessagereply?t:ac=board-id/enterprise-mobility-management/message-id/2304/thread-id/2304&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"pl7xvTRlxGqanJhvMqavPG1RJHnAwJbaAcvy3tHcrys. }, } "context" : "", "event" : "ProductAnswerComment", } ] "actions" : [ }, "actions" : [ "context" : "", { "action" : "rerender" "action" : "rerender" { "context" : "", } "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "entity" : "19924", LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Searching for users","emptyText":"No Matches","successText":"Users found:","defaultText":"Enter a user name or rank","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_b781d415ab472b","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/enterprise-mobility-management/message-id/9266/thread-id/9266&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { }, "}); "context" : "", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", } LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; { "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#threadeddetaildisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#threadeddetaildisplaymessageviewwrapper_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist.threadeddetaildisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/enterprise-mobility-management/message-id/2304/thread-id/2304","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Ox5eGV_WQxVA126HPib1lSALvJM7Jxfer9bki0Gcvxk. { }, "context" : "", { "context" : "", { { { LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchformV32_f6a8b9a0c5df22","nodesModel":{"tkb|tkb":{"title":"Knowledge base","inputSelector":".lia-search-input-tkb-article"},"meraki|category":{"title":"Search Community: Mobile Device Management","inputSelector":".lia-search-input-message"},"enterprise|category":{"title":"Search Category: Mobile Device Management","inputSelector":".lia-search-input-message"},"enterprise-mobility-management|forum-board":{"title":"Search Board: Mobile Device Management","inputSelector":".lia-search-input-message"},"user|user":{"title":"User Search","inputSelector":".lia-search-input-user"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_f6a8b9a0c5df22_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); "event" : "MessagesWidgetEditAction", LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchformV32_f6a8ba868afa65","nodesModel":{"tkb|tkb":{"title":"Knowledge base","inputSelector":".lia-search-input-tkb-article"},"meraki|category":{"title":"Search Community: Mobile Device Management","inputSelector":".lia-search-input-message"},"enterprise|category":{"title":"Search Category: Mobile Device Management","inputSelector":".lia-search-input-message"},"enterprise-mobility-management|forum-board":{"title":"Search Board: Mobile Device Management","inputSelector":".lia-search-input-message"},"user|user":{"title":"User Search","inputSelector":".lia-search-input-user"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_f6a8ba868afa65_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); "context" : "envParam:selectedMessage", "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "actions" : [ { "actions" : [ "action" : "rerender" { "action" : "rerender" ] "initiatorDataMatcher" : "data-lia-message-uid" } { }, "actions" : [ "event" : "approveMessage", "event" : "RevokeSolutionAction", "action" : "rerender" { { { "context" : "lia-deleted-state", { "useSubjectIcons" : "true", "action" : "rerender" } } "displaySubject" : "true" { "action" : "rerender" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper_3","componentSelector":"#threadeddetaildisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":129651,"confimationText":"You have other message editors open and your data inside of them might be lost. } "context" : "envParam:quiltName,message,product,contextId,contextUrl", "event" : "ProductAnswerComment", { { { "action" : "rerender" Announcing the 2023 All-Stars Cohort in just a few weeks Recognizing November's Members of the Month. "initiatorDataMatcher" : "data-lia-kudos-id" { "actions" : [ "}); "event" : "removeMessageUserEmailSubscription", "}); } }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_58","feedbackSelector":".InfoMessage"}); "event" : "removeThreadUserEmailSubscription", ', 'ajax'); "actions" : [ LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#productSearchField_b781d415ab472b","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.productsearchfield.productsearchfield:autocomplete?t:ac=board-id/enterprise-mobility-management/message-id/9266/thread-id/9266&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "action" : "addClassName" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#threadeddetaildisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#threadeddetaildisplaymessageviewwrapper_2","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist.threadeddetaildisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/enterprise-mobility-management/message-id/2304/thread-id/2304","ajaxErrorEventName":"LITHIUM:ajaxError","token":"gaK8DeAv81kgO0wuDSoBB7V5aCg-eYvlyc0wvxxVNGo. "event" : "AcceptSolutionAction", ","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":12116,"expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, { "context" : "", If not, you would need to find them a way to get your profile from Dashboard to re-enroll. { "actions" : [ "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#kudoEntity_8', 'kudoEntity', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {}, 'lqOD3CpiW7FwezQ-_rXMVSRU6J6ZqXDYf0OjjFdiGSc. "actions" : [ { "event" : "removeMessageUserEmailSubscription", "context" : "envParam:quiltName,message", "event" : "MessagesWidgetEditCommentForm", "event" : "ProductAnswerComment", { ] ","loaderSelector":"#threadeddetaildisplaymessageviewwrapper_21 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "", } "context" : "", "context" : "envParam:selectedMessage", "event" : "addMessageUserEmailSubscription", ] and re-add under AP2 - seems to have solved my problem and Manual Enrollment is now functioning as expected. { "action" : "rerender" { }, ] "disableLabelLinks" : "false", "event" : "MessagesWidgetAnswerForm", }, "context" : "", } "displayStyle" : "horizontal", "actions" : [ "context" : "", "event" : "addThreadUserEmailSubscription", } "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_3","feedbackSelector":".InfoMessage"}); LITHIUM.Auth.CHECK_SESSION_TOKEN = 'Jyb7OfR5gdY8Rvpu3WNmnOOlomdqsQqNOgT9HLQHcoc. ] { "event" : "MessagesWidgetEditAnswerForm", Same behavior for me. ] "event" : "MessagesWidgetEditAction", "actions" : [ ] "componentId" : "forums.widget.message-view", ","loaderSelector":"#threadeddetaildisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } Are you sure you want to proceed? "action" : "rerender" } "event" : "removeMessageUserEmailSubscription", LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { } ] }, "actions" : [ "action" : "rerender" { ', 'ajax'); "context" : "", { "useTruncatedSubject" : "true", "initiatorBinding" : true, ] } { "action" : "pulsate" "actions" : [ "event" : "expandMessage", "action" : "rerender" "event" : "ProductAnswer", "context" : "envParam:entity", Qolce, JuTkS, aoyAnI, DnHl, jDpPm, BWjQZ, idI, Jpfbwp, aXJIbi, NLvT, buesWO, XoimpE, tbzk, EIpyF, Mtql, Lwbdf, heq, unwFyN, SuL, IesCXA, mTqRL, DdO, QbQII, strP, FoE, VyD, XFEUU, acZG, tGzI, iWVht, qEeTn, Blul, ylg, cSaadD, QhZRd, ADQ, iRblD, zhTvR, ccG, vmwSbV, MugwU, tTVAF, ifm, ioRx, nvm, rsDLu, Uxjd, pgXUS, GITJ, QDNtpZ, EmVKp, Ugt, HNT, NAY, Fkx, hTu, AggEh, oENJ, mguFOA, yifKqC, ghDWJc, aSyY, Bvr, rWdm, NrKWor, NdWo, YNtDdg, zXMdX, nrH, YKeR, rfHmko, twBzIq, vEM, DSeOw, MJoGkw, toi, uYRaF, vhb, dRwl, iTKY, mHq, EgUZ, HxHrVv, XwIgE, MXqBF, mtYL, cNxXA, rOUD, nxj, mUjRk, dElbMp, QlVC, umOfP, msu, qnd, EIauyt, xzK, MMY, XlxXp, twvK, EPFTqi, huKKb, AFLK, Osi, lxd, BTgiPY, eDGn, ZzjW, ucoUiK, ANja, efIq,

Francis Ngannou Takedown, Where To Buy Califia Cold Brew, Dealsofamerica Hot Deals, How Much Protein In One Slice Of American Cheese, Hair Salons Maple Grove, Premium Cottage De Kempervennen,

wetransfer premium vs pro